General Information

  • ID:  hor006562
  • Uniprot ID:  P84775
  • Protein name:  Insulin-like growth factor I-B
  • Gene name:  igf1-b
  • Organism:  Xenopus laevis (African clawed frog)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  Expressed in adult liver.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Xenopus (subgenus), Xenopus (genus), Xenopodinae (subfamily), Pipidae (family), Pipoidea (superfamily), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0008083 growth factor activity
  • GO BP:  GO:0007165 signal transduction; GO:0010648 negative regulation of cell communication; GO:0023057 negative regulation of signaling; GO:0030178 negative regulation of Wnt signaling pathway; GO:0043066 negative regulation of apoptotic process; GO:0048856 anatomical structure development; GO:0050896 response to stimulus; GO:0060323 head morphogenesis; GO:0090201 negative regulation of release of cytochrome c from mitochondria
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  NNRRAHHRGIVDECCFQSCDFRRLEMYCAPAKPAKSAR
  • Length:  38
  • Propeptide:  NNRRAHHRGIVDECCFQSCDFRRLEMYCAPAKPAKSARSVRAQR
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. Acts as a ligand for IGF1R. Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiatiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways. Binds to integrins. Its binding to integrins and subsequent ternary complex formation with integrins and IGFR1 are essential for IGF1 signaling.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  14-19
  • Structure ID:  AF-P84775-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006562_AF2.pdbhor006562_ESM.pdb

Physical Information

Mass: 509823 Formula: C185H295N65O53S5
Absent amino acids: TW Common amino acids: R
pI: 9.06 Basic residues: 10
Polar residues: 10 Hydrophobic residues: 10
Hydrophobicity: -87.37 Boman Index: -12946
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 41.32
Instability Index: 8123.42 Extinction Coefficient cystines: 1740
Absorbance 280nm: 47.03

Literature

  • PubMed ID:  2302204
  • Title:  Evidence that Xenopus laevis contains two different nonallelic insulin-like growth factor-I genes.